Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01)

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01) spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SWAP70, ID (Switch-associated Protein 70, SWAP-70, KIAA0640, HSPC321) (Azide free) (HRP) discontinued
S8875-01C-HRP 200 µL

SWAP70, ID (Switch-associated Protein 70, SWAP-70, KIAA0640, HSPC321) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Shadow of prion protein (SPRN) Mouse ELISA Kit
H0583 96 Tests

Shadow of prion protein (SPRN) Mouse ELISA Kit

Sign In for Pricing
View Details
Anti-NLRC4 Antibody, Rabbit Polyclonal
MBS8109805-01 0.1 mL

Anti-NLRC4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-NLRC4 Antibody, Rabbit Polyclonal
MBS8109805-02 5x 0.1 mL

Anti-NLRC4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
COL8A2 Peptide - middle region
orb2011164 100 µg

COL8A2 Peptide - middle region

Sign In for Pricing
View Details
HTOR CRISPR All-in-one AAV vector set (with saCas9)(Human)
24067151 3x 1.0 µg DNA

HTOR CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details