Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL8A2 Peptide - middle region

COL8A2 Peptide - middle region

Product Specifications

Product Name Alternative

FECD, FECD1, FLJ00201, MGC116970, MGC116972, PPCD, PPCD2

UniProt

P25067

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL8A2 Rabbit Polyclonal Antibody (orb326324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005193

Preservative

Lyophilized powder

AA Sequence

AAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA6 Rabbit Polyclonal Antibody (Biotin)
orb447752 100 µL

GATA6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Wdr62 (BC057041) Mouse Tagged Lenti ORF Clone
MR211422L3 10 µg

Wdr62 (BC057041) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SIAH2 Conjugated Antibody
orb1620131 100 µL

SIAH2 Conjugated Antibody

Sign In for Pricing
View Details
NCR3 Recombinant Protein
OPCD00804-50UG 50 µg

NCR3 Recombinant Protein

Sign In for Pricing
View Details
Human Pecanex-like protein 1, PCNX ELISA Kit
MBS9339141-01 48 Well

Human Pecanex-like protein 1, PCNX ELISA Kit

Sign In for Pricing
View Details
Human Pecanex-like protein 1, PCNX ELISA Kit
MBS9339141-02 96 Well

Human Pecanex-like protein 1, PCNX ELISA Kit

Sign In for Pricing
View Details