Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretoglobin family 1C member 2 (SG1C2)

This Recombinant Human Secretoglobin family 1C member 2 (SG1C2) spans the amino acid sequence from region 24-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretoglobin family 1C member 2 SCGB1C2

UniProt

P0DMR2

Expression Region

24-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAT Antibody
KC-7571-01 50 μL

CAT Antibody

Sign In for Pricing
View Details
CAT Antibody
KC-7571-02 100 µL

CAT Antibody

Sign In for Pricing
View Details
CAT Antibody
KC-7571-03 1 mL

CAT Antibody

Sign In for Pricing
View Details
4en-PDMB-4en-PINACA
TRC-P184220-50MG 50 mg

4en-PDMB-4en-PINACA

Sign In for Pricing
View Details
Fmoc-L-Homoarginine Hydrochloride Salt
TRC-F633750-500MG 500 mg

Fmoc-L-Homoarginine Hydrochloride Salt

Sign In for Pricing
View Details
VGLL2 Rabbit Polyclonal Antibody
TA369757 100 µL

VGLL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details