Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sigma non-opioid intracellular receptor 1 (SIGMAR1), partial

This Recombinant Human Sigma non-opioid intracellular receptor 1 (SIGMAR1), partial spans the amino acid sequence from region 31-223aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aging-associated gene 8 protein; SR31747-binding protein; Sigma 1-type opioid receptor

UniProt

Q99720

Expression Region

31-223aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thop1 3'UTR Lenti-reporter-Luc Vector
46665084 1.0 µg

Thop1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RNF180 Protein Vector (Human) (pPM-C-HA)
PV057271 500 ng

RNF180 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal ARL3 Antibody (OTI1C6) [Alexa Fluor 647]
NBP2-70206AF647 0.1 mL

Mouse Monoclonal ARL3 Antibody (OTI1C6) [Alexa Fluor 647]

Sign In for Pricing
View Details
Vps72 Rabbit Polyclonal Antibody (Biotin)
orb2136957 100 µL

Vps72 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Twist CRISPR Activation Plasmid (h)
sc-400108-ACT 20 µg

Twist CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Recombinant Mouse IgG Protein, Untagged, Insect-1mg
QP12386-1mg 1mg

Recombinant Mouse IgG Protein, Untagged, Insect-1mg

Sign In for Pricing
View Details