Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps72 Rabbit Polyclonal Antibody (Biotin)

Vps72 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

YL-, Tcfl, YL-1, Tcfl1

UniProt

Q62481

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 Antibody
GWB-C2B606 0.025 mg

CD71 Antibody

Sign In for Pricing
View Details
PFKM Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-63231R-BF488 100 µL

PFKM Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
ARL2BPP8 Protein Vector (Human) (pPM-C-HA)
PV063163 500 ng

ARL2BPP8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
LCMT1 (4A4) Mouse Monoclonal Antibody
CST 5691S 100 µL

LCMT1 (4A4) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
I23O2, CT (IDO2, INDOL1, Indoleamine 2,3-dioxygenase 2, Indoleamine 2,3-dioxygenase-like protein 1, Indoleamine-pyrrole 2,3-dioxygenase-like protein 1) (FITC) discontinued
036851-FITC 200 µL

I23O2, CT (IDO2, INDOL1, Indoleamine 2,3-dioxygenase 2, Indoleamine 2,3-dioxygenase-like protein 1, Indoleamine-pyrrole 2,3-dioxygenase-like protein 1) (FITC) discontinued

Sign In for Pricing
View Details
PD168393 1mg
A12725-1 1 mg

PD168393 1mg

Sign In for Pricing
View Details