Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial

This Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial spans the amino acid sequence from region 54-437aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Channel-activating protease 2; Membrane-type serine protease 2

UniProt

Q9NRS4

Expression Region

54-437aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MelanA (mLANA) (NM_005511) Human Recombinant Protein
TP304190L 1 mg

MelanA (mLANA) (NM_005511) Human Recombinant Protein

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), 1mg/mL
BNUM2168-50 1x 50 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), 1mg/mL

Sign In for Pricing
View Details
Recombinant Human DTD1 Protein (His Tag)
PKSH032363-01 10 µg

Recombinant Human DTD1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DTD1 Protein (His Tag)
PKSH032363-02 50 µg

Recombinant Human DTD1 Protein (His Tag)

Sign In for Pricing
View Details
Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF805657 100 µg

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details
KIR2DL2 Rabbit Polyclonal Antibody
TA361108 100 µL

KIR2DL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details