Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial

This Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial spans the amino acid sequence from region 727-1020aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cdc2-related kinase, arginine/serine-rich; Cell division cycle 2-related protein kinase 7; Cell division protein kinase 12

UniProt

Q9NYV4

Expression Region

727-1020aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHDC9 (NM_152366) Human Recombinant Protein
TP318502L 1 mg

KLHDC9 (NM_152366) Human Recombinant Protein

Sign In for Pricing
View Details
ETS1 (NM_001143820) Human Over-expression Lysate
LC428365 20 µg

ETS1 (NM_001143820) Human Over-expression Lysate

Sign In for Pricing
View Details
KIN (NM_012311) Human Over-expression Lysate
LY402191 100 µg

KIN (NM_012311) Human Over-expression Lysate

Sign In for Pricing
View Details
Thiamine-13C3 Hydrochloride
TRC-T344188-1MG 1 mg

Thiamine-13C3 Hydrochloride

Sign In for Pricing
View Details
ExoBriteTM 410/450 CD9 (Mouse) Flow Antibody (100 tests)
P018-410-500 1x 500 µL

ExoBriteTM 410/450 CD9 (Mouse) Flow Antibody (100 tests)

Sign In for Pricing
View Details
3mC Recombinant Rabbit Monoclonal Antibody [PSH03-21]
HA721957 100 µL

3mC Recombinant Rabbit Monoclonal Antibody [PSH03-21]

Sign In for Pricing
View Details