Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histamine H4 receptor (HRH4), partial

This Recombinant Human Histamine H4 receptor (HRH4), partial spans the amino acid sequence from region 194-304aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AXOR35; G-protein coupled receptor 105; GPRv53; Pfi-013; SP9144

UniProt

Q9H3N8

Expression Region

194-304aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BST-2/Tetherin Protein CF
9939-BS-050 50 µg

Recombinant Human BST-2/Tetherin Protein CF

Sign In for Pricing
View Details
6,6''-Diazido-6,6''-dideoxy-α, α-D-trehalose
GC2126-100mg 100 mg

6,6''-Diazido-6,6''-dideoxy-α, α-D-trehalose

Sign In for Pricing
View Details
[ (Phenylmethoxy) imino]acetic Acid
462469-01 1 g

[ (Phenylmethoxy) imino]acetic Acid

Sign In for Pricing
View Details
[ (Phenylmethoxy) imino]acetic Acid
462469-02 5 g

[ (Phenylmethoxy) imino]acetic Acid

Sign In for Pricing
View Details
Recombinant Metallosphaera sedula Digeranylgeranylglyceryl phosphate synthase (Msed_1933)
orb2907341-01 20 µg

Recombinant Metallosphaera sedula Digeranylgeranylglyceryl phosphate synthase (Msed_1933)

Sign In for Pricing
View Details
Recombinant Metallosphaera sedula Digeranylgeranylglyceryl phosphate synthase (Msed_1933)
orb2907341-02 100 µg

Recombinant Metallosphaera sedula Digeranylgeranylglyceryl phosphate synthase (Msed_1933)

Sign In for Pricing
View Details