Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Metallosphaera sedula Digeranylgeranylglyceryl phosphate synthase (Msed_1933)

This Recombinant Metallosphaera sedula Digeranylgeranylglyceryl phosphate synthase (Msed_1933) spans the amino acid sequence from region 1-284.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A4YI21

Expression Region

1-284

Origin

Metallosphaera sedula (strain ATCC 51363 / DSM 5348)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPFLKLVRIHNVIGAGLGAFTGYVASSMWKIDPTELILAVLVVALVDAGGNAINDVYDV EIDRINKPDRPIPSGAVSLRTATSLSYGLMGVGVILSALQGYLQFLVALLTSVALIFYAR DLKRTGIYGNLVVATATALSLFYGGLSYHEGDWLQRIWIPVLYTFLLTLSREIVKGIEDY RGDLANHVNTLATTRGIASAWRVARVALIITEVTSPLPLFLGYNILYGIVLVPFLYITTK AVLAETSEEGASKARSLLKGSAFLGMVAFALGSLPFQFLFHYLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP3 (Caspase 3, CPP32, Yama, CPP32B, SCA-1, Caspase-3, APOPAIN) (FITC)
MBS6409614-01 0.1 mL

CASP3 (Caspase 3, CPP32, Yama, CPP32B, SCA-1, Caspase-3, APOPAIN) (FITC)

Sign In for Pricing
View Details
CASP3 (Caspase 3, CPP32, Yama, CPP32B, SCA-1, Caspase-3, APOPAIN) (FITC)
MBS6409614-02 5x 0.1 mL

CASP3 (Caspase 3, CPP32, Yama, CPP32B, SCA-1, Caspase-3, APOPAIN) (FITC)

Sign In for Pricing
View Details
Gm129 Protein Vector (Mouse) (pPM-C-HA)
21771024 500 ng

Gm129 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human SMC5 Pre-designed siRNA Set B
SI015297B 1 Each

Human SMC5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Seal Cap for 250mL Erlenmeyer Flasks, 1/pk, 25/cs
CS0010-782925 1 Each

Seal Cap for 250mL Erlenmeyer Flasks, 1/pk, 25/cs

Sign In for Pricing
View Details
SLC22A1 Peptide
orb2017071 100 µg

SLC22A1 Peptide

Sign In for Pricing
View Details