Recombinant Mouse CD40 ligand (Cd40lg), partial
This Recombinant Mouse CD40 ligand (Cd40lg), partial spans the amino acid sequence from region 112-260aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CD40-L; T-cell antigen Gp39; TNF-related activation protein (TRAP) ; Tumor necrosis factor ligand superfamily member 5
UniProt
P27548
Expression Region
112-260aa
Tag
N-terminal mFc1-tagged
Source
Yeast
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
42.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
Dx29600 50 Preparations
Urine Total RNA Purification Maxi Kit Dx (Slurry Format)
Sign In for Pricing
View Details 
BNC472226-100 1x 100 µL
FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
