Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathelicidin antimicrobial peptide (Camp)

This Recombinant Mouse Cathelicidin antimicrobial peptide (Camp) spans the amino acid sequence from region 135-172aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathelin-like protein; CLP; Cramp

UniProt

P51437

Expression Region

135-172aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EMC1 Antibody
NBP3-05171-100ul 100 µL

Rabbit Polyclonal EMC1 Antibody

Sign In for Pricing
View Details
Pola2 Rabbit Polyclonal Antibody
TA334350 100 µL

Pola2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GNB5 Antibody, Biotin conjugated
A23470-100UG 100 µg

GNB5 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TNFSF15 Rabbit Polyclonal Antibody (BF405)
orb2413711 100 µL

TNFSF15 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
FBXL8 (FBL8) discontinued
509411 100 µg

FBXL8 (FBL8) discontinued

Sign In for Pricing
View Details
IPS-06061
HY-170428-01 5 mg

IPS-06061

Sign In for Pricing
View Details