Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon alpha-4 (Ifna4)

This Recombinant Mouse Interferon alpha-4 (Ifna4) spans the amino acid sequence from region 25-186aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-alpha-4

UniProt

P07351

Expression Region

25-186aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD5 Recombinant Protein (Mouse)
RP169949 100 µg

SAMD5 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
UBE1L shRNA (h) Lentiviral Particles
sc-106657-V 200 µL

UBE1L shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Rat ALCAM/CD166 ELISA Kit (DIY Antibody Pairs)
orb2702420 5 Plate

Rat ALCAM/CD166 ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
Cytokeratin 14 rabbit pAb
ES3903-01 50 µL

Cytokeratin 14 rabbit pAb

Sign In for Pricing
View Details
Cytokeratin 14 rabbit pAb
ES3903-02 100 µL

Cytokeratin 14 rabbit pAb

Sign In for Pricing
View Details
ME2 Antibody
A28367-100UG 100 µg

ME2 Antibody

Sign In for Pricing
View Details