Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial

This Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial spans the amino acid sequence from region 22-139aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLP-1 receptor; GLP-1-R; GLP-1R

UniProt

P32301

Expression Region

22-139aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P-CAB agent 2 hydrochloride
T72181-01 25 mg

P-CAB agent 2 hydrochloride

Sign In for Pricing
View Details
P-CAB agent 2 hydrochloride
T72181-02 50 mg

P-CAB agent 2 hydrochloride

Sign In for Pricing
View Details
P-CAB agent 2 hydrochloride
T72181-03 100 mg

P-CAB agent 2 hydrochloride

Sign In for Pricing
View Details
Human PADI6 activation kit by CRISPRa
GA117725 1 Kit

Human PADI6 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Zebrafish SOD1 Antibody Picoband® APC Conjugated
AZO73872-APC 100 µg/Vial

Anti-Zebrafish SOD1 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
SIPA1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
43794126 3x 1.0µg DNA

SIPA1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details