Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 (NDUFB1)

This Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 (NDUFB1) spans the amino acid sequence from region 2-58aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complex I-MNLL (CI-MNLL) ; NADH-ubiquinone oxidoreductase MNLL subunit

UniProt

O75438

Expression Region

2-58aa

Tag

N-terminal GST-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC-1 SMAD/TGFbeta Reporter (Luc) stable cell line
GTR15423072 1 Vial

BC-1 SMAD/TGFbeta Reporter (Luc) stable cell line

Sign In for Pricing
View Details
HOOK3 Antibody, Biotin conjugated
A59490-100UG 100 µg

HOOK3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
DHX58 antibody - N-terminal region
MBS3203165-01 0.1 mL

DHX58 antibody - N-terminal region

Sign In for Pricing
View Details
DHX58 antibody - N-terminal region
MBS3203165-02 5x 0.1 mL

DHX58 antibody - N-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal ALDH18A1 Antibody
NBP2-92069-0.02mL 0.02 mL

Rabbit Polyclonal ALDH18A1 Antibody

Sign In for Pricing
View Details
PRKAB1 Antibody - N-terminal region : FITC (ARP56699_P050-FITC)
ARP56699_P050-FITC 100 µL

PRKAB1 Antibody - N-terminal region : FITC (ARP56699_P050-FITC)

Sign In for Pricing
View Details