Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

This Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB) spans the amino acid sequence from region 37-175aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IsaB; SACOL2660

UniProt

Q5HCQ9

Expression Region

37-175aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Staphylococcus aureus (strain COL)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JH295 hydrate
T61061 25 mg

JH295 hydrate

Sign In for Pricing
View Details
EXOSC10 (Exosome Component 10, Autoantigen PM/Scl 2, P100 Polymyositis-scleroderma Overlap Syndrome-associated Autoantigen, Polymyositis/Scleroderma Autoantigen 100kD, PM/Scl-100, Polymyositis/Scleroderma Autoantigen 2, PMSCL, PMSCL2, RRP6) (Biotin)
126506-Biotin 100 µL

EXOSC10 (Exosome Component 10, Autoantigen PM/Scl 2, P100 Polymyositis-scleroderma Overlap Syndrome-associated Autoantigen, Polymyositis/Scleroderma Autoantigen 100kD, PM/Scl-100, Polymyositis/Scleroderma Autoantigen 2, PMSCL, PMSCL2, RRP6) (Biotin)

Sign In for Pricing
View Details
Cylc1 sgRNA CRISPR Lentivector set (Mouse)
K3216601 3x 1.0 µg

Cylc1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse 6720489N17Rik shRNA (UAS) - Lentiviral mouse 6720489N17Rik shRNA (UAS) (25)
GTR15194021 1 Vial

Lentiviral mouse 6720489N17Rik shRNA (UAS) - Lentiviral mouse 6720489N17Rik shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal POLR3F Antibody [FITC]
NBP1-76929F 0.1 mL

Rabbit Polyclonal POLR3F Antibody [FITC]

Sign In for Pricing
View Details
6""-apiosyl sec-O-glucosylhamaudol
orb1480058 5 mg

6""-apiosyl sec-O-glucosylhamaudol

Sign In for Pricing
View Details