Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5)

This Recombinant Human Ragulator complex protein LAMTOR5 (LAMTOR5) spans the amino acid sequence from region 1-91aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hepatitis B virus X-interacting protein; HBV X-interacting protein; HBX-interacting protein; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5

UniProt

O43504

Expression Region

1-91aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TUBA4A sgRNA gene knockout kit - Lentiviral human TUBA4A sgRNA gene knockout kit (100)
GTR15376711 1 Vial

Lentiviral human TUBA4A sgRNA gene knockout kit - Lentiviral human TUBA4A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Phospho-PKM2 (Tyr105) Rabbit Polyclonal Antibody (Cy3)
orb988718 100 µL

Phospho-PKM2 (Tyr105) Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
EGR2 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb881549 100 µL

EGR2 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Recombinant Mouse Macrophage Migration Inhibitory Factor/MIF (C-6His)
32-8313-10 10 µg

Recombinant Mouse Macrophage Migration Inhibitory Factor/MIF (C-6His)

Sign In for Pricing
View Details
SPINK1 (NM_003122) Human Tagged ORF Clone
RG206574 10 µg

SPINK1 (NM_003122) Human Tagged ORF Clone

Sign In for Pricing
View Details
Olfr988 ORF Vector (Mouse) (pORF)
33603014 1.0 µg DNA

Olfr988 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details