Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative endogenous retrovirus group K member 11-1 Env polyprotein (ERVK11-1)

This Recombinant Human Putative endogenous retrovirus group K member 11-1 Env polyprotein (ERVK11-1) spans the amino acid sequence from region 1-191aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Envelope polyprotein; HERV-K_1p13.3 provirus ancestral Env polyprotein

UniProt

P61568

Expression Region

1-191aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPGAIDDHCPAQPGEEGTAFNVTMGYKYPPLCLGHATRCIHLETQVWAAYLLERLATGKWGHLVSGLSLCPLRQMKRGVIGDTPYFQYKPVGKLCPKNFEGPSKTLIWGDCVNSHAVVLKNDSYALVIDWAPKGYLKNTCSSGGGEFLEATYFISYWEDEDHHPTLHRWFGSFFTLKWEDKDITLHPQGLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (APC)
MBS6505058-01 0.2 mL

USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (APC)

Sign In for Pricing
View Details
USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (APC)
MBS6505058-02 5x 0.2 mL

USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (APC)

Sign In for Pricing
View Details
ARFIP2 Peptide - middle region
orb2003971 100 µg

ARFIP2 Peptide - middle region

Sign In for Pricing
View Details
N-Iodosuccinimide 97% For Synthesis
01467 00025 25 g

N-Iodosuccinimide 97% For Synthesis

Sign In for Pricing
View Details
HTR7 Recombinant Protein (Rat)
RP205340 100 µg

HTR7 Recombinant Protein (Rat)

Sign In for Pricing
View Details
5ml Pipet Tips
27-345 10 Racks of 50 Tips/Unit

5ml Pipet Tips

Sign In for Pricing
View Details