ARFIP2 Peptide - middle region
ARFIP2 Peptide - middle region
Product Specifications
UniProt
P53365
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARFIP2 Rabbit Polyclonal Antibody (orb582340) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6248299-01 0.1 mL
Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu
Sign In for Pricing
View Details MBS6248299-02 5x 0.1 mL
Siglec 1 (Sialic Acid Binding Ig-like Lectin 1, CD169, CD169 Antigen, dJ1009E24.1, DKFZp667F058, FLJ00051, FLJ00055, FLJ00073, FLJ00411, FLJ32150, Sialic Acid-binding Ig-like Lectin 1, Sialic Acid-binding Ig-like Lectin-1, Sialoadhesin, Sialoadhesin Precu
Sign In for Pricing
View Details 