Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Osmia cornuta Odorant-binding protein 1

This Recombinant Osmia cornuta Odorant-binding protein 1 spans the amino acid sequence from region 20-143aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

M4VRP1

Expression Region

20-143aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Osmia cornuta

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDQDAVIAKYMEYLMPNVKPCADEFHMTEDQAKNIQQAADGMDLKQLGCLKGCVMKRMGMLTGNNEFHLEPVYTMIESVHTGNDAEIQDVKKIAEECISSIQGEPDECNIGTKYSDCYIQKLFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum DNA gyrase subunit B (gyrB), partial
MBS1182597 Inquire

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum DNA gyrase subunit B (gyrB), partial

Sign In for Pricing
View Details
Mouse Tbx1 Pre-designed siRNA Set B
SI114335B 1 Each

Mouse Tbx1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ERMAP sgRNA CRISPR Lentivector (Human) (Target 1)
K0693302 1.0 µg DNA

ERMAP sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ATG5 Rabbit pAb
EA350-01 50 µL

ATG5 Rabbit pAb

Sign In for Pricing
View Details
ATG5 Rabbit pAb
EA350-02 100 µL

ATG5 Rabbit pAb

Sign In for Pricing
View Details
ADHESIVE CHANNELCM.63 Sign & Label Carriers & Holders
GDT63A 50 Pack (50 Piece (s) x 1 Pack)

ADHESIVE CHANNELCM.63 Sign & Label Carriers & Holders

Sign In for Pricing
View Details