Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4), partial

This Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4), partial spans the amino acid sequence from region 79-133aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serotonin receptor 4

UniProt

Q13639

Expression Region

79-133aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ONECUT3 Rabbit Polyclonal Antibody (HRP)
orb2134914 100 µL

ONECUT3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ARRDC3 (m) -PR
sc-141274-PR 10 µM - 20 µL

ARRDC3 (m) -PR

Sign In for Pricing
View Details
WFIKKN1 Human siRNA Oligo Duplex (Locus ID 117166)
SR314616 1 Kit

WFIKKN1 Human siRNA Oligo Duplex (Locus ID 117166)

Sign In for Pricing
View Details
Geranylgeranyl MTS
sc-490107 5 mg

Geranylgeranyl MTS

Sign In for Pricing
View Details
Vdr siRNA Oligos set (Mouse)
49475174 3x 5 nmol

Vdr siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Phospho-MAP3K9+MAP3K10 (Thr312 + Thr266) Polyclonal Antibody, Cy3 Conjugated
bs-6779R-Cy3 100 µL

Phospho-MAP3K9+MAP3K10 (Thr312 + Thr266) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details