Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ONECUT3 Rabbit Polyclonal Antibody (HRP)

ONECUT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OC3

UniProt

O60422

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LOC390874

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQRLVFTD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

XP_944823

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Internexin, alpha, ID (INA, 66kD Neurofilament Protein, Alpha-Internexin, Alpha Inx, FLJ18662, FLJ57501, MGC12702, NEF 5, NEF5, Neurofilament 5, Neurofilament 66, Neurofilament-66 NF 66, NF66, NF-66) (MaxLight 650) discontinued
I8442-74K-ML650 100 µL

Internexin, alpha, ID (INA, 66kD Neurofilament Protein, Alpha-Internexin, Alpha Inx, FLJ18662, FLJ57501, MGC12702, NEF 5, NEF5, Neurofilament 5, Neurofilament 66, Neurofilament-66 NF 66, NF66, NF-66) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Gorab Mouse shRNA Plasmid (Locus ID 98376)
TR505554 1 Kit

Gorab Mouse shRNA Plasmid (Locus ID 98376)

Sign In for Pricing
View Details
HK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0962906 1.0 µg DNA

HK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human TGF-beta 1 Alexa Fluor 405 MAb (Clone 1018746)
IC10502V-100UG 100 µg

Human TGF-beta 1 Alexa Fluor 405 MAb (Clone 1018746)

Sign In for Pricing
View Details
SCF Protein, Rat, Recombinant
TMPS-00124-01 5 µg

SCF Protein, Rat, Recombinant

Sign In for Pricing
View Details
SCF Protein, Rat, Recombinant
TMPS-00124-02 10 µg

SCF Protein, Rat, Recombinant

Sign In for Pricing
View Details