Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor IX (F9), partial

This Recombinant Human Coagulation factor IX (F9), partial spans the amino acid sequence from region 93-129aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Christmas factor; Plasma thromboplastin component

UniProt

P00740

Expression Region

93-129aa

Tag

N-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD151 PE
1P-149-T100 100 Tests

Anti-Hu CD151 PE

Sign In for Pricing
View Details
ZNF580 Human shRNA Plasmid Kit (Locus ID 51157)
TR318708 1 Kit

ZNF580 Human shRNA Plasmid Kit (Locus ID 51157)

Sign In for Pricing
View Details
CD39L4 Rabbit pAb, FITC conjugated
orb2892146 100 µL

CD39L4 Rabbit pAb, FITC conjugated

Sign In for Pricing
View Details
Rat Rreb1 Pre-designed siRNA Set B
SI212243B 1 Each

Rat Rreb1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Zebrafish PSMA1 Antibody Picoband® HRP Conjugated
AZQ6DGX8-HRP 100 µg/Vial

Anti-Zebrafish PSMA1 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
NEP162
orb3135971-01 10 mg

NEP162

Sign In for Pricing
View Details