Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tumor necrosis factor (Tnf), partial (Active)

This Recombinant Rat Tumor necrosis factor (Tnf), partial spans the amino acid sequence from region 80-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a) ; Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF) ; Intracellular domain 1 (ICD1) ; Intracellular domain 2 (ICD2) ; C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2

UniProt

P16599

Expression Region

80-235aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Bioactivity

Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 18.58-33.99 pg/mL.

Form

Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GAP43 Antibody (R1Q51)
RHD25702 100 μg

Anti-GAP43 Antibody (R1Q51)

Sign In for Pricing
View Details
P/P041/NT/PP-DIA315-1 Prohibited Activity Signs (No Adhesive)
196887 1 Pack (1 Panel (s) x 1 Pack)

P/P041/NT/PP-DIA315-1 Prohibited Activity Signs (No Adhesive)

Sign In for Pricing
View Details
3,5-Dibromo-2-hydroxybenzaldehyde
23486590-25g 25 g

3,5-Dibromo-2-hydroxybenzaldehyde

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein Rv1269c
CSB-MP358663MVZ-01 10 µg

Recombinant Mycobacterium tuberculosis Protein Rv1269c

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein Rv1269c
CSB-MP358663MVZ-02 50 µg

Recombinant Mycobacterium tuberculosis Protein Rv1269c

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis Protein Rv1269c
CSB-MP358663MVZ-03 200 µg

Recombinant Mycobacterium tuberculosis Protein Rv1269c

Sign In for Pricing
View Details