Recombinant Mycobacterium tuberculosis Protein Rv1269c
Product Specifications
Abbreviation
Recombinant Mycobacterium tuberculosis protein Rv1269c protein
UniProt
P9WM45
Expression Region
36-124aa
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Target Sequence
ADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN
Tag
C-terminal hFc1-tagged
Type
Developed Protein
Source
Mammalian cell
Field of Research
Others
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
38.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SR419691 2 nmol
Prkce (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Sign In for Pricing
View Details MBS8434338-01 0.05 mg
Mouse Reg2 Recombinant Protein N-6 His Tag Lyophilized
Sign In for Pricing
View Details MBS8434338-02 5x 0.05 mg
Mouse Reg2 Recombinant Protein N-6 His Tag Lyophilized
Sign In for Pricing
View Details 
MBS6131969-01 0.1 mL
KCNK10 (TREK2, Potassium Channel Subfamily K Member 10, Outward Rectifying Potassium Channel Protein TREK-2, TREK-2 K(+) Channel Subunit, FLJ43399, K2p10.1, TREK-2) (AP)
Sign In for Pricing
View Details MBS6131969-02 5x 0.1 mL
KCNK10 (TREK2, Potassium Channel Subfamily K Member 10, Outward Rectifying Potassium Channel Protein TREK-2, TREK-2 K(+) Channel Subunit, FLJ43399, K2p10.1, TREK-2) (AP)
Sign In for Pricing
View Details