Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)
This Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active) spans the amino acid sequence from region 28-229aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
UniProt
A0A2K5VGQ6
Expression Region
28-229aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Cell Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/ml can bind human TNFSF14, the EC50 is 11.83-14.23 ng/ml.
Form
Lyophilized powder
Molecular Weight
23.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS715413-01 0.05 mg
Rabbit anti-human Trifunctional enzyme subunit beta, mitochondrial polyclonal Antibody
Sign In for Pricing
View Details MBS715413-02 0.1 mg
Rabbit anti-human Trifunctional enzyme subunit beta, mitochondrial polyclonal Antibody
Sign In for Pricing
View Details MBS715413-03 5x 0.1 mg
Rabbit anti-human Trifunctional enzyme subunit beta, mitochondrial polyclonal Antibody
Sign In for Pricing
View Details 
A12852-1-PE 100 µg/Vial
Anti-MICALL2 Antibody Picoband®, PE Conjugate
Sign In for Pricing
View Details K0646906 1.0 µg DNA
DYX3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details