Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5), Biotinylated

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3'-Dithiobis-L-Valine
TRC-D493795-250MG 250 mg

3,3'-Dithiobis-L-Valine

Sign In for Pricing
View Details
Colloidal Gold Conjugated Glycine max Lectin (Soybean) -SBA-,  5nm
GP-1301-5 1 mL

Colloidal Gold Conjugated Glycine max Lectin (Soybean) -SBA-, 5nm

Sign In for Pricing
View Details
Ephrin A2 (EFNA2) Rabbit Polyclonal Antibody
AP06639PU-N 100 µg

Ephrin A2 (EFNA2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2-Bromopropoxy)benzene
TRC-B997393-2.5G 2.5 g

(2-Bromopropoxy)benzene

Sign In for Pricing
View Details
Recombinant ABAT Monoclonal Antibody
AN301692L-01 50 µL

Recombinant ABAT Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ABAT Monoclonal Antibody
AN301692L-02 100 µL

Recombinant ABAT Monoclonal Antibody

Sign In for Pricing
View Details