Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH)

This Recombinant Human CUB domain-containing protein (SPADH) spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc57 (NM_025657) Mouse Untagged Clone
MC201395 10 µg

Lrrc57 (NM_025657) Mouse Untagged Clone

Sign In for Pricing
View Details
Goat Alanine glyoxylate aminotransferase 2 like 2 (AGXT2L2) ELISA kit
GTR10413912 96 Well

Goat Alanine glyoxylate aminotransferase 2 like 2 (AGXT2L2) ELISA kit

Sign In for Pricing
View Details
Recombinant mouse LC3B/MAP1LC3B protein
ATGP3668-100 100 µg

Recombinant mouse LC3B/MAP1LC3B protein

Sign In for Pricing
View Details
APC anti-mouse CD36
E16FMA036-025U 25 µg

APC anti-mouse CD36

Sign In for Pricing
View Details
Human ASGR2, Tag Free (ECD)
HA210842-01 20 µg

Human ASGR2, Tag Free (ECD)

Sign In for Pricing
View Details
Human ASGR2, Tag Free (ECD)
HA210842-02 50 µg

Human ASGR2, Tag Free (ECD)

Sign In for Pricing
View Details