Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flock house virus Protein B2 (B2)

This Recombinant Flock house virus Protein B2 (B2) spans the amino acid sequence from region 1-106aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B2

UniProt

P68831

Expression Region

1-106aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Flock house virus (FHV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKAPEEAKPTLEERLRKLELSHSLPTTGSDPPPAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ATP1B4 Antibody (4D5D4) [Alexa Fluor 594]
NBP3-05909AF594 0.1 mL

Mouse Monoclonal ATP1B4 Antibody (4D5D4) [Alexa Fluor 594]

Sign In for Pricing
View Details
Zfp498 Rat shRNA Plasmid (Locus ID 363872)
TL707378 1 Kit

Zfp498 Rat shRNA Plasmid (Locus ID 363872)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli bla Polyclonal Antibody
MBS7144259 Inquire

Rabbit anti-Escherichia coli bla Polyclonal Antibody

Sign In for Pricing
View Details
JMJD8 Rabbit Polyclonal Antibody (HRP)
orb2141832 100 µL

JMJD8 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
RPS6KA1 Antibody
A44878-50UL 50 μL

RPS6KA1 Antibody

Sign In for Pricing
View Details
Sheep anti-Rabbit Albumin Antibody
20-1731 2 ml

Sheep anti-Rabbit Albumin Antibody

Sign In for Pricing
View Details