Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD8 Rabbit Polyclonal Antibody (HRP)

JMJD8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP14397, C16orf20

UniProt

B2RNS7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC339123

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001005920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM9 polyclonal rabbit affinity purified
181 003 50 µg

TRIM9 polyclonal rabbit affinity purified

Sign In for Pricing
View Details
Rabbit Polyclonal SUV420h1 Antibody [Dylight 680]
NBP1-97313FR 0.1 mL

Rabbit Polyclonal SUV420h1 Antibody [Dylight 680]

Sign In for Pricing
View Details
CFHR2 Antibody
MBS1499581-01 0.05 mg

CFHR2 Antibody

Sign In for Pricing
View Details
CFHR2 Antibody
MBS1499581-02 0.1 mg

CFHR2 Antibody

Sign In for Pricing
View Details
CFHR2 Antibody
MBS1499581-03 5x 0.1 mg

CFHR2 Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human DSG3 (Desmoglein 3) Expressed in Baculovirus/Insect expression system with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, PaRoom Temperatureial (50-615aa)
MPX4180K Each

Magic™ Membrane Protein Human DSG3 (Desmoglein 3) Expressed in Baculovirus/Insect expression system with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, PaRoom Temperatureial (50-615aa)

Sign In for Pricing
View Details