Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yphE (yphE)

This Recombinant Bacillus subtilis Uncharacterized protein yphE (yphE) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Uncharacterized protein yphE

UniProt

P50744

Expression Region

1-67

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLALMKMWFALGSMGLMFLAVASIYLSRFKCQNRFLKIAISSFAYMCMLISGIIVFVVV FSGPVNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GHDC Protein Vector (Rat) (pPM-C-His)
PV270113 500 ng

GHDC Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
MGAT4A (mannosyl (alpha-1,3-) -Glycoprotein beta-1,4-N-acetylglucosaminyltransferase, Isozyme A, GNT-IV, GNT-IVA) (HRP)
248709-HRP 100 µL

MGAT4A (mannosyl (alpha-1,3-) -Glycoprotein beta-1,4-N-acetylglucosaminyltransferase, Isozyme A, GNT-IV, GNT-IVA) (HRP)

Sign In for Pricing
View Details
ADAM11 Human Pre-designed siRNA Set A
HY-RS00268 1 Set

ADAM11 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Goat IgG (H&L) Antibody Pre-Adsorbed
orb347028 1 mg

Goat IgG (H&L) Antibody Pre-Adsorbed

Sign In for Pricing
View Details
LLY 507
TWC05337-01 25 mg

LLY 507

Sign In for Pricing
View Details
LLY 507
TWC05337-02 50 mg

LLY 507

Sign In for Pricing
View Details