Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis Protein AaeX (aaeX)

This Recombinant Yersinia pestis Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A4THE8

Expression Region

1-67

Origin

Yersinia pestis (strain Pestoides F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW26F4-aR/W 10x 96 Well Plates

Goat anti-Rabbit IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details
5,6-Diaminopyrimidine-2,4-diol-13C3 Hydrochloride
TRC-D416757-2.5MG 2.5 mg

5,6-Diaminopyrimidine-2,4-diol-13C3 Hydrochloride

Sign In for Pricing
View Details
Human SAMD4B activation kit by CRISPRa
GA110511 1 Kit

Human SAMD4B activation kit by CRISPRa

Sign In for Pricing
View Details
(3-Nitrophenyl)hydrazine
TRC-N234456-500MG 500 mg

(3-Nitrophenyl)hydrazine

Sign In for Pricing
View Details
Fibrillin 1 (FBN1) Rabbit Polyclonal Antibody
TA376144 100 µL

Fibrillin 1 (FBN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase B2 Polyclonal Antibody
E-AB-40640-01 25 µL

Carboxypeptidase B2 Polyclonal Antibody

Sign In for Pricing
View Details