Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Protein AaeX (aaeX)

This Recombinant Enterobacter sp. Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

A4WF56

Expression Region

1-67

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVFVVFGLSFPPIFFELILSLAIFWLVRKLLAPTGIYDFVWHPALFNTALYCCLFY LISRMFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC38 Lentiviral Activation Particles (h)
sc-407165-LAC 200 µL

TTC38 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
ZNF777 Rabbit pAb, PE-Cy5.5 conjugated
orb2860046 100 µL

ZNF777 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
C-hexaAMP
BLG-C332-005 0.5 μmoL

C-hexaAMP

Sign In for Pricing
View Details
Dctn4 (NM_026302) Mouse Tagged Lenti ORF Clone
MR207350L3 10 µg

Dctn4 (NM_026302) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Triisopropyl Borate
TRC-T795490-10G 10 g

Triisopropyl Borate

Sign In for Pricing
View Details
Rabbit RNF216 Antibody
orb1523594-01 10 µL

Rabbit RNF216 Antibody

Sign In for Pricing
View Details