Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 1 Glycoprotein N (gN)

This Recombinant Human herpesvirus 1 Glycoprotein N (gN) spans the amino acid sequence from region 24-91.

Product Specifications

Product Name Alternative

Glycoprotein N, gN, Protein UL49.5, Protein UL49A

UniProt

O09800

Expression Region

24-91

Origin

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DAGPRGEPPGEEGGRDGIGGARCETQNTGQMSAPGALVPFYVGMASMGVCIIAHVCQICQ RLLAAGHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDS Polyclonal Antibody
E-AB-90527-01 60 µL

SDS Polyclonal Antibody

Sign In for Pricing
View Details
SDS Polyclonal Antibody
E-AB-90527-02 120 µL

SDS Polyclonal Antibody

Sign In for Pricing
View Details
SDS Polyclonal Antibody
E-AB-90527-03 200 µL

SDS Polyclonal Antibody

Sign In for Pricing
View Details
Cinchocaine
TRC-C274055-500MG 500 mg

Cinchocaine

Sign In for Pricing
View Details
Recombinant Human LAG3/CD223 Protein (Fc Tag)
PKSH033597-01 10 µg

Recombinant Human LAG3/CD223 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human LAG3/CD223 Protein (Fc Tag)
PKSH033597-02 50 µg

Recombinant Human LAG3/CD223 Protein (Fc Tag)

Sign In for Pricing
View Details