Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus haemolyticus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4L7Y9

Expression Region

1-70

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMSIMFIGIGLVEALPIIG VVIAFMTLFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMT1 Protein Vector (Rat) (pPM-C-HA)
PV264596 500 ng

DNMT1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Zebrafish N-Cadherin/CDH2 Antibody Picoband® Cy3 Conjugated
AZQ90275-Cy3 100 µg/Vial

Anti-Zebrafish N-Cadherin/CDH2 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Secretin Receptor Polyclonal Antibody
orb310965-01 50 μL

Secretin Receptor Polyclonal Antibody

Sign In for Pricing
View Details
Secretin Receptor Polyclonal Antibody
orb310965-02 100 µL

Secretin Receptor Polyclonal Antibody

Sign In for Pricing
View Details
NUMB Mouse Monoclonal Antibody [Clone ID: LBI3B2]
AMM15374VCF 100 µg

NUMB Mouse Monoclonal Antibody [Clone ID: LBI3B2]

Sign In for Pricing
View Details
ITPK1 Antibody
orb758363-01 25 µg

ITPK1 Antibody

Sign In for Pricing
View Details