Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-72.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P41015

Expression Region

1-72

Origin

Bacillus caldotenax

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIAAQPELRPVLQTTMFIGVALVEALPI IGVVFSFIYLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NFKB p65 Ready-To-Use IHC Kit
IHC0206H 50 Tests

Human NFKB p65 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase (crtQ), partial
MBS7076556 Inquire

Recombinant Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase (crtQ), partial

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody [Clone ID: LBI3E7]
AMM14385VCF 100 µg

SENP2 Mouse Monoclonal Antibody [Clone ID: LBI3E7]

Sign In for Pricing
View Details
MS4A15 (NM_001098835) Human Tagged Lenti ORF Clone
RC213714L4 10 µg

MS4A15 (NM_001098835) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZNF274 Mouse Monoclonal Antibody
BF8519-01 100 µL

ZNF274 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ZNF274 Mouse Monoclonal Antibody
BF8519-02 200 µL

ZNF274 Mouse Monoclonal Antibody

Sign In for Pricing
View Details