Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Envelope small membrane protein (E)

This Recombinant Bat coronavirus Rp3/2004 Envelope small membrane protein (E) spans the amino acid sequence from region 1-76.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q3I5J3

Expression Region

1-76

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camptothecin
SIH-242-1G 1 g

Camptothecin

Sign In for Pricing
View Details
ExoQuick® UltraPure EV Isolation Kit
EQ UltraPure 10 Reactions

ExoQuick® UltraPure EV Isolation Kit

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR560300 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
CD134 Recombinant Rabbit monoclonal Antibody
HA751343 100 µL

CD134 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL
BNC042013-100 1x 100 µL

CD3e, Mouse (145-2C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NCAM1 Recombinant Rabbit Monoclonal Antibody [PSH06-53]
HA722756 100 µL

NCAM1 Recombinant Rabbit Monoclonal Antibody [PSH06-53]

Sign In for Pricing
View Details