Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C17orf109 homolog

This Recombinant Mouse Uncharacterized protein C17orf109 homolog spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf109 homolog

UniProt

Q8BT42

Expression Region

1-78

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATDFVGEIRSVGERLLLKLQQLPQAEPVELVAFSIIVLFTATVLVLGLIACSCCCAHC CCSESRQRKIPVRPTKPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Olfactory receptor 51T1 (OR51T1)
orb2905931-01 20 µg

Recombinant Human Olfactory receptor 51T1 (OR51T1)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 51T1 (OR51T1)
orb2905931-02 100 µg

Recombinant Human Olfactory receptor 51T1 (OR51T1)

Sign In for Pricing
View Details
Rat Total Carnitine (TC) ELISA Kit
MBS2608023-01 48 Well

Rat Total Carnitine (TC) ELISA Kit

Sign In for Pricing
View Details
Rat Total Carnitine (TC) ELISA Kit
MBS2608023-02 96 Well

Rat Total Carnitine (TC) ELISA Kit

Sign In for Pricing
View Details
Rat Total Carnitine (TC) ELISA Kit
MBS2608023-03 5x 96 Well

Rat Total Carnitine (TC) ELISA Kit

Sign In for Pricing
View Details
Rat Total Carnitine (TC) ELISA Kit
MBS2608023-04 10x 96 Well

Rat Total Carnitine (TC) ELISA Kit

Sign In for Pricing
View Details