Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51T1 (OR51T1)

This Recombinant Human Olfactory receptor 51T1 (OR51T1) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Olfactory receptor 51T1, Olfactory receptor OR11-26

UniProt

Q8NGJ9

Expression Region

1-327

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIFNNTTSSSSNFLLTAFPGLECAHVWISIPVCCLYTIALLGNSMIFLVIITKRRLHKP MYYFLSMLAAVDLCLTITTLPTVLGVLWFHAREISFKACFIQMFFVHAFSLLESSVLVAM AFDRFVAICNPLNYATILTDRMVLVIGLVICIRPAVFLLPLLVAINTVSFHGGHELSHPF CYHPEVIKYTYSKPWISSFWGLFLQLYLNGTDVLFILFSYVLILRTVLGIVARKKQQKAL STCVCHICAVTIFYVPLISLSLAHRLFHSTPRVLCSTLANIYLLLPPVLNPIIYSLKTKT IRQAMFQLLQSKGSWGFNVRGLRGRWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details