Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C ATP synthase subunit c (atpE)

This Recombinant Salmonella paratyphi C ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C0Q2N7

Expression Region

1-79

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED6 Mouse Monoclonal Antibody [Clone ID: OTI3C9]
CF808183 100 µg

MED6 Mouse Monoclonal Antibody [Clone ID: OTI3C9]

Sign In for Pricing
View Details
5,8-Epoxy-13-cis Retinoic Acid (Mixture of Diastereomers)
TRC-E589820-5MG 5 mg

5,8-Epoxy-13-cis Retinoic Acid (Mixture of Diastereomers)

Sign In for Pricing
View Details
Hawkinsin TFA Salt
TRC-H195025-5MG 5 mg

Hawkinsin TFA Salt

Sign In for Pricing
View Details
QuicKey Pro Human Cortisol ELISA Kit
E-OSEL-H0006-01 24 Tests

QuicKey Pro Human Cortisol ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human Cortisol ELISA Kit
E-OSEL-H0006-02 48 Tests

QuicKey Pro Human Cortisol ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human Cortisol ELISA Kit
E-OSEL-H0006-03 96 Tests

QuicKey Pro Human Cortisol ELISA Kit

Sign In for Pricing
View Details