Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8D3J8

Expression Region

1-79

Origin

Wigglesworthia glossinidia brevipalpis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSINADLLYISAAIIMGFASIGAAIGIGILGGKFLEGAARQPDLIPTLRTQFFIVMGLV DAIPMISVGLGLYLIFAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thyroglobulin (TG) ELISA Kit
RDR-TG-Hu-01 96 Tests

Human Thyroglobulin (TG) ELISA Kit

Sign In for Pricing
View Details
Human Thyroglobulin (TG) ELISA Kit
RDR-TG-Hu-02 48 Tests

Human Thyroglobulin (TG) ELISA Kit

Sign In for Pricing
View Details
CEP170 Antibody
A12386-50UG 50 µg

CEP170 Antibody

Sign In for Pricing
View Details
Scarb2 3'UTR Luciferase Stable Cell Line
TU219955 1.0 mL

Scarb2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BHLHA9 ORF Vector (Human) (pORF)
ORF016157 1.0 µg DNA

BHLHA9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IgG2, Fc (PE)
MBS6129372-01 0.1 mL

IgG2, Fc (PE)

Sign In for Pricing
View Details