Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa ATP synthase subunit C, plastid (atpE)

This Recombinant Cuscuta reflexa ATP synthase subunit C, plastid (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit C, plastid, ATP synthase F0 sector subunit C, ATPase subunit III, Lipid-binding protein

UniProt

A7M953

Expression Region

1-81

Origin

Cuscuta reflexa (Southern Asian dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Napsin A Antibody (NAPSA/1865R) - Azide and BSA Free
NBP3-08379 100 µg

Rabbit Monoclonal Napsin A Antibody (NAPSA/1865R) - Azide and BSA Free

Sign In for Pricing
View Details
CRTAC1 Rabbit Polyclonal Antibody (FITC)
orb2102202 100 µL

CRTAC1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CGKII Rabbit Polyclonal Antibody
E53P02727 100 µL

CGKII Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTPN13 (Biotin)
573833-01 50 µg

PTPN13 (Biotin)

Sign In for Pricing
View Details
PTPN13 (Biotin)
573833-02 100 µg

PTPN13 (Biotin)

Sign In for Pricing
View Details
Single-minded homolog 1 Antibody / SIM1
F54660-0.08ML 0.08 mL

Single-minded homolog 1 Antibody / SIM1

Sign In for Pricing
View Details