Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa ATP synthase subunit C, plastid (atpE)

This Recombinant Cuscuta reflexa ATP synthase subunit C, plastid (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit C, plastid, ATP synthase F0 sector subunit C, ATPase subunit III, Lipid-binding protein

UniProt

A7M953

Expression Region

1-81

Origin

Cuscuta reflexa (Southern Asian dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ranitidine bismuth citrate
MBS5813600 Inquire

Ranitidine bismuth citrate

Sign In for Pricing
View Details
Anti-MARK3 Rabbit Monoclonal Antibody, Carrier-free
M05355-1-carrier-free 100 µL

Anti-MARK3 Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
DKFZp686E2433 Antibody - N-terminal region
ARP51740_P050-25UL 25 µL

DKFZp686E2433 Antibody - N-terminal region

Sign In for Pricing
View Details
Arpc3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6108304 1.0 µg DNA

Arpc3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
HPGD Protein Vector (Rat) (pPB-N-His)
PV273359 500 ng

HPGD Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
AFP Antibody
orb1251946 100 µg

AFP Antibody

Sign In for Pricing
View Details