Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Lactuca sativa ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q56P08

Expression Region

1-81

Origin

Lactuca sativa (Garden lettuce)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRPF1B/TRIM24-IN-1
T89525-01 10 mg

BRPF1B/TRIM24-IN-1

Sign In for Pricing
View Details
BRPF1B/TRIM24-IN-1
T89525-02 50 mg

BRPF1B/TRIM24-IN-1

Sign In for Pricing
View Details
Human EGR1 ELISA Kit
EHE0050 96 Tests

Human EGR1 ELISA Kit

Sign In for Pricing
View Details
BMAL1 Rabbit pAb
E2251540 100 µL

BMAL1 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Snap91 shRNA (UAS) - Lentiviral mouse Snap91 shRNA (UAS, iRFP) plasmid
GTR15179908 1 Vial

Lentiviral mouse Snap91 shRNA (UAS) - Lentiviral mouse Snap91 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
TRPV6 Conjugated Antibody
C43287 100 µL

TRPV6 Conjugated Antibody

Sign In for Pricing
View Details