Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. ATP synthase subunit c (atpE)

This Recombinant Acinetobacter sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6FFK5

Expression Region

1-81

Origin

Acinetobacter sp. (strain ADP1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGGT1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV647580 1.0 µg DNA

UGGT1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rabbit Polyclonal ALDH1A2 Antibody
NBP2-92915-0.02mL 0.02 mL

Rabbit Polyclonal ALDH1A2 Antibody

Sign In for Pricing
View Details
GLS Antibody / Glutaminase
RQ6734 100 µg

GLS Antibody / Glutaminase

Sign In for Pricing
View Details
ZNF266 Polyclonal Antibody, FITC Conjugated
A61944-100 100 µL

ZNF266 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Malignant melanoma, metastatic malignant melanoma and nevus tissue array, including TNM, clinical stage and HMB45&MelanA result, 98 cases/98 cores
MME981 98 Cases / 98 Cores

Malignant melanoma, metastatic malignant melanoma and nevus tissue array, including TNM, clinical stage and HMB45&MelanA result, 98 cases/98 cores

Sign In for Pricing
View Details
Cholesteryl Benzoate
sc-211083 250 mg

Cholesteryl Benzoate

Sign In for Pricing
View Details