Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c (atpE)

This Recombinant ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B6YR09

Expression Region

1-82

Origin

Azobacteroides pseudotrichonymphae genomovar. CFP2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLSILLQVATGTGLAKLGEALGAGLAVIGAGLGIGKIGESAMEGIARQPEAAGDIRMNM IIAAALVEGVSLFAVVVCGFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[IHC]ZAP70 Mouse Monoclonal Antibody, 1 pack = 50 µL
BAL3811 1 Each

[IHC]ZAP70 Mouse Monoclonal Antibody, 1 pack = 50 µL

Sign In for Pricing
View Details
Recombinant Petromyzon marinus Rhodopsin (RHO)
orb2905300-01 20 µg

Recombinant Petromyzon marinus Rhodopsin (RHO)

Sign In for Pricing
View Details
Recombinant Petromyzon marinus Rhodopsin (RHO)
orb2905300-02 100 µg

Recombinant Petromyzon marinus Rhodopsin (RHO)

Sign In for Pricing
View Details
BTLA Antibody
ABD4812 100 µg

BTLA Antibody

Sign In for Pricing
View Details
Testis Expressed 13A (TEX13A) Antibody (HRP)
abx311758-01 20 µg

Testis Expressed 13A (TEX13A) Antibody (HRP)

Sign In for Pricing
View Details
Testis Expressed 13A (TEX13A) Antibody (HRP)
abx311758-02 50 µg

Testis Expressed 13A (TEX13A) Antibody (HRP)

Sign In for Pricing
View Details