Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Petromyzon marinus Rhodopsin (RHO)

This Recombinant Petromyzon marinus Rhodopsin (RHO) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

Q98980

Expression Region

1-353

Origin

Petromyzon marinus (Sea lamprey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGENFYIPFSNKTGLARSPFEYPQYYLAEPWKYSVLAAYMFFLILVGFPVNFLTLF VTVQHKKLRTPLNYILLNLAVANLFMVLFGFTLTMYSSMNGYFVFGPTMCNFEGFFATLG GEMSLWSLVVLAIERYIVICKPMGNFRFGSTHAYMGVAFTWFMALSCAAPPLVGWSRYLP EGMQCSCGPDYYTLNPNFNNESFVIYMFLVHFIIPFIVIFFCYGRLLCTVKEAAAAQQES ASTQKAEKEVTRMVVLMVIGFLVCWVPYASVAFYIFTHQGSDFGATFMTVPAFFAKTSAL YNPIIYILMNKQFRNCMITTLCCGKNPLGDEDSGASTSKTEVSSVSTSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), Biotin conjugate, 0.1mg/mL
BNCB0304-100 1x 100 µL

CD106 / VCAM1 (B-K9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details