Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit c, chloroplastic (atpH)

This Recombinant ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1KVY0

Expression Region

1-82

Origin

Scenedesmus obliquus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIVAAASVVSAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UQCC (UQCC1) activation kit by CRISPRa
GA110638 1 Kit

Human UQCC (UQCC1) activation kit by CRISPRa

Sign In for Pricing
View Details
IGLVI-38 ORF Vector (Human) (pORF)
24756011 1.0 µg DNA

IGLVI-38 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Biotinylated Human LC3B Protein, Avitag™, His Tag (MALS verified)
LCB-H82Q3-25ug 25 µg

Biotinylated Human LC3B Protein, Avitag™, His Tag (MALS verified)

Sign In for Pricing
View Details
Amy2a3 (NM_031502) Rat Tagged ORF Clone
RR208681 10 µg

Amy2a3 (NM_031502) Rat Tagged ORF Clone

Sign In for Pricing
View Details
IgG1, Rat Isotype Control (Azide Free)
I1904-76UX 500 µg

IgG1, Rat Isotype Control (Azide Free)

Sign In for Pricing
View Details
IL1RN (12M4) Mouse Monoclonal antibody
E28PE5455 100 µL

IL1RN (12M4) Mouse Monoclonal antibody

Sign In for Pricing
View Details