Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE)

This Recombinant Prochlorococcus marinus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q46J53

Expression Region

1-82

Origin

Prochlorococcus marinus (strain NATL2A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITTAASVVAAGLAVGLGAIGPGIGQGSAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF652 siRNA (Mouse)
MBS8213927-01 15 nmol

ZNF652 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF652 siRNA (Mouse)
MBS8213927-02 30 nmol

ZNF652 siRNA (Mouse)

Sign In for Pricing
View Details
ZNF652 siRNA (Mouse)
MBS8213927-03 5x 30 nmol

ZNF652 siRNA (Mouse)

Sign In for Pricing
View Details
CMGA Antibody
56-038 400 µL

CMGA Antibody

Sign In for Pricing
View Details
Tip60 Polyclonal Antibody
ABP60694-01 30 µL

Tip60 Polyclonal Antibody

Sign In for Pricing
View Details
Tip60 Polyclonal Antibody
ABP60694-02 100 µL

Tip60 Polyclonal Antibody

Sign In for Pricing
View Details