Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Feline coronavirus Envelope small membrane protein (E)

This Recombinant Feline coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

Q52PA5

Expression Region

1-82

Origin

Feline coronavirus (strain FIPV WSU-79/1146) (FCoV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFPRAFTIIDDHGMVVSVFFWLLLIIILILFSIALLNVIKLCMVCCNLGKTIIVLPARH AYDAYKTFMQTKAYNPDEAFLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D1 (CCND1) Mouse Monoclonal Antibody [Clone:1G8]
E45M16580 100 µg

Cyclin D1 (CCND1) Mouse Monoclonal Antibody [Clone:1G8]

Sign In for Pricing
View Details
Anti-Cathepsin B/CTSB Antibody Picoband®
PB9046 100 µg/Vial

Anti-Cathepsin B/CTSB Antibody Picoband®

Sign In for Pricing
View Details
PSGL-1/CD162 Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated
orb3124511 100 µL

PSGL-1/CD162 Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated

Sign In for Pricing
View Details
sCD27 Ligand, Human Recombinant
7125-10 10 µg

sCD27 Ligand, Human Recombinant

Sign In for Pricing
View Details
ZNF521 Polyclonal Antibody
bs-6978R 100 µL

ZNF521 Polyclonal Antibody

Sign In for Pricing
View Details
(3-bromo-6-chloro-2-fluorophenyl) (furan-2-yl) methanol
PC1020394-01 250 mg

(3-bromo-6-chloro-2-fluorophenyl) (furan-2-yl) methanol

Sign In for Pricing
View Details