Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Porcine respiratory coronavirus Envelope small membrane protein (E)

This Recombinant Porcine respiratory coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, ORF 3, Protein 4, Protein X1

UniProt

P69611

Expression Region

1-82

Origin

Porcine respiratory coronavirus (strain 86/137004 / isolate British) (PRCoV) (PRCV)

Field of Research

Respiratory Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFPRALTVIDDNGMVISIIFWFLLIIILILLSIALLNIIKLCMVCCNLGRTVIIVPVQH AYDAYKNFMRIKAYNPDGALLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1E (NM_001185114) Human Tagged ORF Clone Lentiviral Particle
RC231132L3V 200 µL

CD1E (NM_001185114) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
JNJ-6640
T212088-01 10 mg

JNJ-6640

Sign In for Pricing
View Details
JNJ-6640
T212088-02 50 mg

JNJ-6640

Sign In for Pricing
View Details
STING ligand-1
HY-114399-01 5 mg

STING ligand-1

Sign In for Pricing
View Details
STING ligand-1
HY-114399-02 10 mM - 1 mL

STING ligand-1

Sign In for Pricing
View Details
STING ligand-1
HY-114399-03 10 mg

STING ligand-1

Sign In for Pricing
View Details